PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587074.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 342aa    MW: 39007.4 Da    PI: 8.6284
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587074.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.22.1e-55171431129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL +kv ++++ +  +i evd++k+ePwdLp k+k +ekewyfF+ rdkky+tg r+nrat++gyWkatgkd+e+++ 
  XP_009587074.1  17 LPPGFRFHPTDEELITHYLSNKVVDSNFFA-IAIGEVDLNKIEPWDLPWKAKMGEKEWYFFCVRDKKYPTGLRTNRATTAGYWKATGKDREIFR- 109
                     79*************************877.78***************888999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +++lvg+kktLvfykgrapkgekt+Wv+heyrle
  XP_009587074.1 110 GKSLVGMKKTLVFYKGRAPKGEKTNWVIHEYRLE 143
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6213167IPR003441NAC domain
PROSITE profilePS5100558.7217167IPR003441NAC domain
PfamPF023652.6E-2818142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MENYSGLVKE DDQQMELPPG FRFHPTDEEL ITHYLSNKVV DSNFFAIAIG EVDLNKIEPW  60
DLPWKAKMGE KEWYFFCVRD KKYPTGLRTN RATTAGYWKA TGKDREIFRG KSLVGMKKTL  120
VFYKGRAPKG EKTNWVIHEY RLEGRLSLHN LPKTAKNEWV ICRVFQKSCG GKKIHISGLV  180
KLNSDENEMG NNFLPPLTDS SSYTGKFKPA ASQSSHVHCF SNFFTAQKSQ ENMINCFNNS  240
PNFSALSNPM NNLPISTFSC NQIVPVQSSF PSQVSFGMQN PIILKTLLEN YTQNFKKEEI  300
VSLSQETKLS PDMNNEISSI VSNLGMGRRS LEDQSLDCLW SY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-5381736171NAC domain-containing protein 19
4dul_A1e-5381736171NAC domain-containing protein 19
1ut7_B1e-5381736171NO APICAL MERISTEM PROTEIN
1ut7_A1e-5381736171NO APICAL MERISTEM PROTEIN
1ut4_B1e-5381736171NO APICAL MERISTEM PROTEIN
1ut4_A1e-5381736171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-103HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587074.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-131NC100_ARATH; NAC domain-containing protein 100
TrEMBLK4C8E40.0K4C8E4_SOLLC; Uncharacterized protein
STRINGSolyc06g069710.2.11e-180(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-130NAC domain containing protein 100